PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G090600.1.p
Common NameLOC101761464, SETIT_034940mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 566aa    MW: 63350.6 Da    PI: 7.705
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G090600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.13e-11111151445
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         W ++E+ ll+++++++G g+W  +a+++g +++  qc++++ 
  Seita.9G090600.1.p 111 WNADEEILLLEGIEMYGLGNWLEVAEHVG-TKSKQQCIDHYT 151
                         *****************************.**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250242.4E-17637561IPR016827Transcriptional adaptor 2
SMARTSM002911.6E-104792IPR000433Zinc finger, ZZ-type
PfamPF005693.2E-94990IPR000433Zinc finger, ZZ-type
SuperFamilySSF578508.12E-1451114No hitNo description
CDDcd023354.07E-265199No hitNo description
PROSITE profilePS5013510.8245194IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135705380IPR000433Zinc finger, ZZ-type
SuperFamilySSF466892.54E-12104157IPR009057Homeodomain-like
PROSITE profilePS5129321.917106158IPR017884SANT domain
SMARTSM007173.3E-10107156IPR001005SANT/Myb domain
PfamPF002495.1E-11110151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-8111153IPR009057Homeodomain-like
CDDcd001675.72E-11111152No hitNo description
SuperFamilySSF466892.33E-20469554IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MGRSRGVPNS GDDDTGHRSK RRRVSSSGDA TDTISAAMGG AGEGGGKKAL YHCNYCNKDI  60
SGKIRIKCSK CPDFDLCVEC FSVGAEVTPH RSNHSYRVMD NLSFPLICPD WNADEEILLL  120
EGIEMYGLGN WLEVAEHVGT KSKQQCIDHY TTAYMNSPCY PLPDMSHVNG KNRKELLAMA  180
KVQGESKKGT SLLPGELTPK AESPFSPSRV KLEEALGDGP AGRSPSHMAG GANKKASNAG  240
QNKDGANISK VEDGHVDRSV GVKKPRYSAD EGPSLTELSG YNSKRHEFDP EYDNDAEQAL  300
AEMEFKETDS ETDRELKLRV LRIYLSRLDE RKRRKEFILE RNLLFPNPLE KDLTNEDKEV  360
YHRYKVFMRF LSKEEHEALV RSVIEERKIR RRIQELQECR SAGCRTLAEA KIHIEQKRKK  420
EYELNAQKAK ESGQLIPNNK SVQKMNRPVK IESDGNLDPK KGGAGLDSPK TTGLTSVKQW  480
DDWDIVGLPG AELLSASEKL LCCQNRLLPS HYLRMQEVLM QEIFKGSVHK KEDAHVLFKV  540
DPTKVDTVYD MVTKKLGNHE EAPTV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11923KRRRV
2330335RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0413330.0BT041333.1 Zea mays full-length cDNA clone ZM_BFb0092G09 mRNA, complete cds.
GenBankKJ7274980.0KJ727498.1 Zea mays clone pUT5357 MYB-related transcription factor (MYBR66) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981760.10.0PREDICTED: transcriptional adapter ADA2
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLK4A7T40.0K4A7T4_SETIT; Uncharacterized protein
STRINGSi034940m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77083847